PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.06G126000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family ARF
Protein Properties Length: 858aa    MW: 95657.6 Da    PI: 6.5967
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.06G126000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B375.36.9e-24161262199
                          EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE CS
                   B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkl 84 
                          f+k+lt sd++++g +++ +++a+e+      + k++ +++l+ +d++g++W++++i+r++++r++l++GW+ Fv++++L +gD ++F  
  Manes.06G126000.1.p 161 FCKTLTASDTSTHGGFSVLRRHADEClppldmS-KQPPTQELIAKDLHGNEWRFRHIFRGQPRRHLLQSGWSVFVSSKRLVAGDAFIFL- 248
                          99*****************************63.4445569************************************************. PP

                          -SSSEE..EEEEE-S CS
                   B3  85 dgrsefelvvkvfrk 99 
                           + +++el+v+v+r+
  Manes.06G126000.1.p 249 -RGENGELRVGVRRA 262
                          .449999*****996 PP

2Auxin_resp1219.1e-40287369183
           Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                          a+ha+st+++F+v+Y+Pr+s++eF+v+v+++++++k+++++GmRfkm+fe+e+++e+r++Gt+vg++d+dp rW++SkWr+Lk
  Manes.06G126000.1.p 287 AWHAISTGTMFTVYYKPRTSPAEFIVPVDRYMESVKNNYTIGMRFKMRFEGEEAPEQRFTGTIVGIEDADPKRWRDSKWRCLK 369
                          89*******************************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.27E-40157290IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.2E-41158276IPR015300DNA-binding pseudobarrel domain
CDDcd100178.48E-22159261No hitNo description
SMARTSM010192.8E-23161263IPR003340B3 DNA binding domain
PfamPF023628.2E-22161262IPR003340B3 DNA binding domain
PROSITE profilePS5086311.984161263IPR003340B3 DNA binding domain
PfamPF065076.8E-37287369IPR010525Auxin response factor
PfamPF023094.5E-12720818IPR033389AUX/IAA domain
SuperFamilySSF542773.43E-12727808No hitNo description
PROSITE profilePS5174524.182731813IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008285Biological Processnegative regulation of cell proliferation
GO:0009737Biological Processresponse to abscisic acid
GO:0009911Biological Processpositive regulation of flower development
GO:0010047Biological Processfruit dehiscence
GO:0010150Biological Processleaf senescence
GO:0010227Biological Processfloral organ abscission
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 858 aa     Download sequence    Send to blast
MMDSSEISIK GNGGNVRGDS FSSPYSEPND PRNAMEGQKS HSTCPVSARD AETALYTELW  60
HACAGPLVTV PRERERVFYF PQGHIEQVAA STNQVADQQM PVYDLPSKIL CTVINVQLKA  120
EPDTDEVFAQ VTLLPDPNQD ESAVDKEPPL PPPPRFHVHS FCKTLTASDT STHGGFSVLR  180
RHADECLPPL DMSKQPPTQE LIAKDLHGNE WRFRHIFRGQ PRRHLLQSGW SVFVSSKRLV  240
AGDAFIFLRG ENGELRVGVR RAMRQQGNVP SSVISSHSMH LGVLATAWHA ISTGTMFTVY  300
YKPRTSPAEF IVPVDRYMES VKNNYTIGMR FKMRFEGEEA PEQRFTGTIV GIEDADPKRW  360
RDSKWRCLKV RWDETSTIPR PERVSPWSIE PALAPPALNP LPMPRPKRPR SNVVPSSPDS  420
SVLTREGSSK VTIDPQPPSG YSRVLQGQEF STLRGNFAES NESDTAEKSL MWPSSIEDEK  480
VDVVSASRRH GSESWMPSGR QEPTYTDLLS GFGAHADSIH GFGASFVDQT AASASRKLIL  540
DQEGKFNLPS SHWSVMSSGL SLKLPESNAK VPVQGRDMPF QARGHIRCSA FNELPMLNGH  600
RVEQSHGNWL MPPPPPSHFD NQTHARDLGP KPILVPEHET GKSTDGKCKL FGIPLFSNPV  660
TPEPAAHRSM VYEPTSAHPQ CHQLRALECD QRSEQSKGSK LADDNEHEKQ FQGGILHTRD  720
NQGKAQSVST RSCTKVHKQG IALGRSVDLT KFNNYNELIA ELDQLFEFDG ELMAPKRNWL  780
IVYTDDEGDM MLVGDDPWQE FVGMVRKIYI YTREEVQKMN PGALNSKGDE NLLDVEGMDA  840
KDMKCLRLPP ANSTDIC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-1795439118354Auxin response factor 1
4ldw_A1e-1795439118354Auxin response factor 1
4ldw_B1e-1795439118354Auxin response factor 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00574DAPTransfer from AT5G62000Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012090599.10.0PREDICTED: auxin response factor 2-like
SwissprotQ94JM30.0ARFB_ARATH; Auxin response factor 2
TrEMBLA0A067JF520.0A0A067JF52_JATCU; Auxin response factor
STRINGPOPTR_0012s10790.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF32813366
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62000.30.0auxin response factor 2